TRIM10 Rabbit Polyclonal Antibody
CAT#: TA337300
Rabbit Polyclonal Anti-TRIM10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIM10 antibody: synthetic peptide directed towards the N terminal of human TRIM10. Synthetic peptide located within the following region: PNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | tripartite motif containing 10 |
Database Link | |
Background | TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that t |
Synonyms | HERF1; RFB30; RNF9 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |