KBTBD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-KBTBD6 antibody is: synthetic peptide directed towards the N-terminal region of Human KBTBD6. Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	kelch repeat and BTB domain containing 6
Database Link	NP_690867 Entrez Gene 89890 Human UniProt ID Q86V97
Background	The function of this protein remains unknown.
Synonyms	DKFZp547E1912; DKFZp547M073; FLJ58260
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Bovine: 86%; Rat: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.