MAGEB10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MAGEB10 antibody is: synthetic peptide directed towards the N-terminal region of Human MAGEB10. Synthetic peptide located within the following region: MPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	MAGE family member B10
Database Link	NP_872312 Entrez Gene 139422 Human UniProt ID Q96LZ2
Background	This gene encodes a member of the B subfamily of the melanoma associated antigen protein family. The encoded protein is specifically expressed in testis and tumor cells.
Synonyms	FLJ32965; MGC120394
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.