C17orf64 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C17orf64 antibody: synthetic peptide directed towards the middle region of human C17orf64. Synthetic peptide located within the following region: NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	chromosome 17 open reading frame 64
Database Link	NP_859058 Entrez Gene 124773 Human UniProt ID Q86WR6
Background	The function of this protein remains unknown.
Synonyms	C17orf64
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 92%; Rabbit: 92%; Dog: 85%; Bovine: 85%; Yeast: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.