XRRA1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-XRRA1 antibody: synthetic peptide directed towards the N terminal of human XRRA1. Synthetic peptide located within the following region: MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	X-ray radiation resistance associated 1
Database Link	NP_892014 Entrez Gene 143570 Human UniProt ID Q6P2D8
Background	XRRA1 may be involved in the response of cells to X-ray radiation.
Synonyms	AI449753
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.