LRRC56 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC56 antibody: synthetic peptide directed towards the N terminal of human LRRC56. Synthetic peptide located within the following region: LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	leucine rich repeat containing 56
Database Link	NP_932341 Entrez Gene 115399 Human UniProt ID Q8IYG6
Background	LRRC56 contains 3 LRR (leucine-rich) repeats. The exact function of LRRC56 remains unknown.
Synonyms	DKFZp761L1518; FLJ00101
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Dog: 86%; Horse: 86%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.