FAM36A (COX20) Rabbit Polyclonal Antibody
CAT#: TA337607
Rabbit Polyclonal Anti-COX20 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-COX20 antibody: synthetic peptide directed towards the C terminal of human COX20. Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 13 kDa |
Gene Name | COX20 cytochrome c oxidase assembly factor |
Database Link | |
Background | COX20 is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of COX20 remains unknown. |
Synonyms | FAM36A |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 90%; Mouse: 90%; Horse: 79%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |