LRRC23 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC23 antibody: synthetic peptide directed towards the middle region of human LRRC23. Synthetic peptide located within the following region: ISLHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	leucine rich repeat containing 23
Database Link	NP_964013 Entrez Gene 10233 Human UniProt ID Q53EV4
Background	LRRC23 contains 5 LRR (leucine-rich) repeats. The exact function of LRRC23 remains unknown.
Synonyms	LRPB7
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%; Horse: 86%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.