Micos13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-2410015M20Rik antibody is: synthetic peptide directed towards the C-terminal region of 2410015M20Rik. Synthetic peptide located within the following region: TGLEMPQLPTPPKIKFPNFRDSWNSGIISVMSALSVAPSKAREYSKEGWE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	13 kDa
Gene Name	RIKEN cDNA 2410015M20 gene
Database Link	NP_694792 Entrez Gene 224904 Mouse UniProt ID Q8R404
Background	The function of this protein remains unknown.
Synonyms	QIL1
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.