PGM1 Rabbit Polyclonal Antibody
CNY 4628.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-PGM1 antibody: synthetic peptide directed towards the middle region of human PGM1. Synthetic peptide located within the following region: ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 61 kDa | 
| Gene Name | phosphoglucomutase 1 | 
| Database Link | |
| Background | PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. | 
| Synonyms | CDG1T; GSD14 | 
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 86% | 
| Reference Data | |
| Protein Pathways | Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway, Starch and sucrose metabolism | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
