SUMF1 Rabbit Polyclonal Antibody

CAT#: TA337720

Rabbit Polyclonal Anti-SUMF1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3
    • 100 ug

CNY 3080.00


Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SUMF1 antibody is: synthetic peptide directed towards the N-terminal region of Human SUMF1. Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 41 kDa
Gene Name sulfatase modifying factor 1
Background This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Synonyms AAPA3037; FGE; UNQ3037
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...