SUMF1 Rabbit Polyclonal Antibody
CAT#: TA337720
Rabbit Polyclonal Anti-SUMF1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SUMF1 antibody is: synthetic peptide directed towards the N-terminal region of Human SUMF1. Synthetic peptide located within the following region: SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | sulfatase modifying factor 1 |
Database Link | |
Background | This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. |
Synonyms | AAPA3037; FGE; UNQ3037 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Inhibition of endogenous miR-23a/miR-377 in CHO cells enhances difficult-to-express recombinant lysosomal sulfatase activity
,Amadi, IM;Agrawal, V;Christianson, T;Bardliving, C;Shamlou, P;LeBowitz, JH;,
Biotechnol. Prog.
,PubMed ID 31990124
[SUMF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |