SUMF1 (NM_182760) Human Recombinant Protein
CAT#: TP311092
Recombinant protein of human sulfatase modifying factor 1 (SUMF1), 20 µg
View other "SUMF1" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211092 protein sequence
Red=Cloning site Green=Tags(s) MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSQEAGTGAGAGSLAGSCGCGTPQRPGAHGSSAAAHRY SREANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFV NSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVS WNDAVAYCTWAGKRLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAP VDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARS QNTPDSSASNLGFRCAADRLPTMD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_877437 |
Locus ID | 285362 |
UniProt ID | Q8NBK3 |
Refseq Size | 2179 |
Cytogenetics | 3p26.1 |
Refseq ORF | 1122 |
Synonyms | AAPA3037; FGE; UNQ3037 |
Summary | This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405331 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431307 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431311 | SUMF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405331 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 1 |
CNY 3080.00 |
|
LY431307 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 2 |
CNY 3080.00 |
|
LY431311 | Transient overexpression lysate of sulfatase modifying factor 1 (SUMF1), transcript variant 3 |
CNY 3080.00 |
|
PH311092 | SUMF1 MS Standard C13 and N15-labeled recombinant protein (NP_877437) |
CNY 19520.00 |
|
TP720417 | Recombinant protein of human sulfatase modifying factor 1 (SUMF1) |
CNY 1800.00 |