Syntaxin binding protein 4 (STXBP4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-STXBP4 antibody is: synthetic peptide directed towards the N-terminal region of Human STXBP4. Synthetic peptide located within the following region: SVNKESMIGVSFEEAKSIITGAKLRLESAWEIAFIRQKSDNIQPENLSCT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	syntaxin binding protein 4
Database Link	NP_848604 Entrez Gene 252983 Human UniProt ID Q6ZWJ1
Background	STXBP4 plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane. STXBP4 inhibits the translocation of SLC2A4 from intracellular vesicles to the plasma membrane by STX4A binding and preventing the interaction between STX4A and VAMP2. Stimulation with insulin disrupts the interaction with STX4A, leading to increased levels of SLC2A4 at the plasma membrane. STXBP4 may also play a role in the regulation of insulin release by pancreatic beta cells after stimulation by glucose.
Synonyms	Synip
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.