Erc2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Erc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Erc2. Synthetic peptide located within the following region: TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	115 kDa
Gene Name	ELKS/RAB6-interacting/CAST family member 2
Database Link	NP_808482 Entrez Gene 238988 Mouse UniProt ID Q6PH08
Background	Erc2 is rhought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. It seems to act together with BSN and may recruit liprin-alpha proteins to the CAZ.
Synonyms	CAST; CAST1; ELKSL; KIAA0378; MGC133063; MGC133064; SPBC110; Spc110
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.