G6pc3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-G6pc3 antibody is: synthetic peptide directed towards the middle region of Mouse G6pc3. Synthetic peptide located within the following region: PEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIAC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	glucose 6 phosphatase, catalytic, 3
Database Link	NP_787949 Entrez Gene 68401 Mouse UniProt ID Q6NSQ9
Background	G6pc3 hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. It may form with the glucose-6-phosphate transporter (SLC37A4/G6PT) a ubiquitously expressed complex responsible for glucose production through glycogenolysis and gluconeogenesis. G6pc3 probably required for normal neutrophil function.
Synonyms	G6Pase-beta; SCN4; UGRP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.