C8orf45 (MCMDC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MCMDC2 antibody: synthetic peptide directed towards the middle region of human MCMDC2. Synthetic peptide located within the following region: RSITVYIPGKKFGEDIDQQMTFPVQCSFWSFVDVDSSSRRNAQKINTLIG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	minichromosome maintenance domain containing 2
Database Link	NP_775789 Entrez Gene 157777 Human UniProt ID Q4G0Z9
Background	The function of MCMDC2 remains unknown.
Synonyms	C8orf45
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.