PLEKHH2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PLEKHH2 antibody: synthetic peptide directed towards the C terminal of human PLEKHH2. Synthetic peptide located within the following region: WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	168 kDa
Gene Name	pleckstrin homology, MyTH4 and FERM domain containing H2
Database Link	NP_742066 Entrez Gene 130271 Human UniProt ID Q8IVE3
Background	PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
Synonyms	PLEKHH1L
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.