RDH10 Rabbit Polyclonal Antibody
CAT#: TA337803
Rabbit Polyclonal Anti-RDH10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RDH10 antibody: synthetic peptide directed towards the N terminal of human RDH10. Synthetic peptide located within the following region: QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 38 kDa |
Gene Name | retinol dehydrogenase 10 (all-trans) |
Database Link | |
Background | RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle. All-trans retinal is isomerized to 11-cis retinal by the retinal G protein-coupled receptor (RGR; MIM 600342) when the retinal pigment epithelium (RPE) is illuminated. [supplied by OMIM] |
Synonyms | SDR16C4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |