ALDH4A1 Rabbit Polyclonal Antibody

CAT#: TA337809

Rabbit Polyclonal Anti-Aldh4a1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhS
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhS, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhS, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name aldehyde dehydrogenase 4 family member A1
Background Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.
Synonyms ALDH4; P5CD; P5CDh
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...