NSP3 (SH2D3C) Rabbit Polyclonal Antibody
CAT#: TA337811
Rabbit Polyclonal Anti-SH2D3C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SH2D3C antibody: synthetic peptide directed towards the N terminal of human SH2D3C. Synthetic peptide located within the following region: AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 77 kDa |
Gene Name | SH2 domain containing 3C |
Database Link | |
Background | SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration. |
Synonyms | CHAT; NSP3; PRO34088; SHEP1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Characterisation of the Semliki Forest Virus-host cell interactome reveals the viral capsid protein as an inhibitor of nonsense-mediated mRNA decay
,null,
PLoS Pathogens
,PubMed ID 34019569
[SH2D3C]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |