C5orf35 (SETD9) Rabbit Polyclonal Antibody

Specifications

Product Data
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SETD9 antibody: synthetic peptide directed towards the N terminal of human SETD9. Synthetic peptide located within the following region: QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	SET domain containing 9
Database Link	NP_714917 Entrez Gene 133383 Human UniProt ID Q8NE22
Background	The exact functions of C5orf35 remain unknown.
Synonyms	C5orf35
Note	Immunogen Sequence Homology: Human: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.