ZNF569 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF569 antibody: synthetic peptide directed towards the N terminal of human ZNF569. Synthetic peptide located within the following region: LTEEKGNECQKKFANVFPLNSDFFPSRHNLYEYDLFGKCLEHNFDCHNNV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	zinc finger protein 569
Database Link	NP_689697 Entrez Gene 148266 Human UniProt ID Q5MCW4
Background	ZNF569 may be involved in transcriptional regulation.
Synonyms	ZAP1; ZNF
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.