LGI4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LGI4 antibody is: synthetic peptide directed towards the C-terminal region of Human LGI4. Synthetic peptide located within the following region: GGRFERRTDIPEAEDVYATRHFQAGGDVFLCLTRYIGDSMVRLGLGAGGW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	leucine-rich repeat LGI family member 4
Database Link	NP_644813 Entrez Gene 163175 Human UniProt ID Q8N135
Background	The function of this protein remains unknown.
Synonyms	LGIL3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.