G6PC3 Rabbit Polyclonal Antibody
CAT#: TA337919
Rabbit Polyclonal Anti-G6PC3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-G6PC3 antibody is: synthetic peptide directed towards the N-terminal region of Human G6PC3. Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 39 kDa |
| Gene Name | glucose-6-phosphatase catalytic subunit 3 |
| Database Link | |
| Background | This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein. |
| Synonyms | SCN4; UGRP |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Sheep: 85% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
