EGLN2 Rabbit Polyclonal Antibody
CAT#: TA337938
Rabbit Polyclonal Anti-EGLN2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 16 kDa |
Gene Name | egl-9 family hypoxia inducible factor 2 |
Database Link | |
Background | The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms. |
Synonyms | EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Sheep: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Pathways in cancer, Renal cell carcinoma |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Hypoxia-inducible factor prolyl-4-hydroxylase-1 is a convergent point in the reciprocal negative regulation of NF-κB and p53 signaling pathways
,Ullah, K;Rosendahl, AH;Izzi, V;Bergmann, U;Pihlajaniemi, T;Mäki, JM;Myllyharju, J;,
Sci Rep
,PubMed ID 29222481
[EGLN2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |