CLNK Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CLNK antibody is: synthetic peptide directed towards the C-terminal region of Human CLNK. Synthetic peptide located within the following region: SRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	cytokine dependent hematopoietic cell linker
Database Link	NP_443196 Entrez Gene 116449 Human UniProt ID Q7Z7G1
Background	MIST is a member of the SLP76 family of adaptors. MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation.
Synonyms	MIST
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.