STK19 Rabbit Polyclonal Antibody
CAT#: TA337952
Rabbit Polyclonal Anti-STK19 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-STK19 antibody is: synthetic peptide directed towards the middle region of Human STK19. Synthetic peptide located within the following region: PPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | serine/threonine kinase 19 |
Database Link | |
Background | This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. |
Synonyms | D6S60; D6S60E; G11; HLA-RP1; RP1 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 92%; Mouse: 86%; Rat: 79% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |