Sostdc1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sostdc1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sostdc1. Synthetic peptide located within the following region: EWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	sclerostin domain containing 1
Database Link	NP_079588 Entrez Gene 66042 Mouse UniProt ID Q9CQN4
Background	Sostdc1 may be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction. It enhances Wnt signaling and inhibits TGF-beta signaling and directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Synonyms	CDA019; DKFZp564D206; ECTODIN; USAG-1; USAG1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.