SCNM1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCNM1 antibody is: synthetic peptide directed towards the C-terminal region of Human SCNM1. Synthetic peptide located within the following region: EVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	sodium channel modifier 1
Database Link	NP_076946 Entrez Gene 79005 Human UniProt ID Q9BWG6
Background	SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a mutations.
Synonyms	MGC3180
Note	Immunogen Sequence Homology: Human: 100%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.