Dpysl5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dpysl5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dpysl5. Synthetic peptide located within the following region: LADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	dihydropyrimidinase-like 5
Database Link	NP_075534 Entrez Gene 65254 Mouse UniProt ID Q9EQF6
Background	Dpysl5 may have a function in neuronal differentiation and/or axon growth.
Synonyms	CRAM; CRMP-5; CRMP5; DRP-5; FLJ45383; OTTHUMP00000200913; Ulip6
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.