EEFSEC Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EEFSEC antibody is: synthetic peptide directed towards the C-terminal region of Human EEFSEC. Synthetic peptide located within the following region: AVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDAD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	eukaryotic elongation factor, selenocysteine-tRNA specific
Database Link	NP_068756 Entrez Gene 60678 Human UniProt ID P57772
Background	The function of this protein remains unknown.
Synonyms	EFSEC; SELB
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 91%; Rat: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.