DSU (MREG) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MREG antibody is: synthetic peptide directed towards the C-terminal region of Human MREG. Synthetic peptide located within the following region: DSLLSVTKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	melanoregulin
Database Link	NP_060470 Entrez Gene 55686 Human UniProt ID Q8N565
Background	MREG plays a role in the incorporation of pigments into hair. MREG may function in membrane fusion and regulate the biogenesis of disk membranes of photoreceptor rod cells.
Synonyms	DSU; WDT2
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.