CHRDL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHRDL2 antibody is: synthetic peptide directed towards the N-terminal region of Human CHRDL2. Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	3 kDa
Gene Name	chordin-like 2
Database Link	NP_056239 Entrez Gene 25884 Human UniProt ID Q6WN34
Background	CHRDL2 is implicated in tumor angiogenesis. CHRDL2 may inhibits BMPs activity by blocking their interaction with their receptors. CHRDL2 has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. CHRDL2 may play a role during myoblast and osteoblast differentiation, and maturation.
Synonyms	BNF1; CHL2
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 90%; Mouse: 83%; Rat: 75%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.