CYFIP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CYFIP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYFIP1. Synthetic peptide located within the following region: WAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	145 kDa
Gene Name	cytoplasmic FMR1 interacting protein 1
Database Link	NP_055423 Entrez Gene 23191 Human UniProt ID Q7L576
Background	CYFIP1 is a component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. CYFIP1 promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA By similarity. CYFIP1 regulates formation of membrane ruffles and lamellipodia. CYFIP1 plays a role in axon outgrowth. CYFIP1 binds to F-actin but not to RNA. Part of the WAVE complex that regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. Regulator of epithelial morphogenesis. CYFIP1 may act as an invasion suppressor in cancers.
Synonyms	P140SRA-1; SHYC; SRA-1; SRA1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%
Reference Data
Protein Pathways	Regulation of actin cytoskeleton

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.