CYFIP1 Rabbit Polyclonal Antibody
CAT#: TA338086
Rabbit Polyclonal Anti-CYFIP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CYFIP1 antibody is: synthetic peptide directed towards the C-terminal region of Human CYFIP1. Synthetic peptide located within the following region: WAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 145 kDa |
Gene Name | cytoplasmic FMR1 interacting protein 1 |
Database Link | |
Background | CYFIP1 is a component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. CYFIP1 promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA By similarity. CYFIP1 regulates formation of membrane ruffles and lamellipodia. CYFIP1 plays a role in axon outgrowth. CYFIP1 binds to F-actin but not to RNA. Part of the WAVE complex that regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. Regulator of epithelial morphogenesis. CYFIP1 may act as an invasion suppressor in cancers. |
Synonyms | P140SRA-1; SHYC; SRA-1; SRA1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93% |
Reference Data | |
Protein Pathways | Regulation of actin cytoskeleton |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |