NUDT5 Rabbit Polyclonal Antibody
CAT#: TA338097
Rabbit Polyclonal Anti-NUDT5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NUDT5 antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT5. Synthetic peptide located within the following region: EKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | nudix hydrolase 5 |
Database Link | |
Background | Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites. |
Synonyms | hNUDT5; YSA1; YSA1H; YSAH1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 79%; Rabbit: 79% |
Reference Data | |
Protein Pathways | Purine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |