S1PR2 Rabbit Polyclonal Antibody
CAT#: TA338190
Rabbit Polyclonal Anti-S1PR2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4381.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-S1PR2 antibody is: synthetic peptide directed towards the N-terminal region of Human S1PR2. Synthetic peptide located within the following region: MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVE |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 38 kDa |
| Gene Name | sphingosine-1-phosphate receptor 2 |
| Database Link | |
| Background | This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. This protein participates in sphingosine 1-phosphate-induced cell proliferation, survival, and transcriptional activation. |
| Synonyms | AGR16; EDG-5; EDG5; Gpcr13; H218; LPB2; S1P2 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Dog: 86%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Horse: 79% |
| Reference Data | |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
