OST4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-OST4 antibody is: synthetic peptide directed towards the C-terminal region of Human OST4. Synthetic peptide located within the following region: MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	4 kDa
Gene Name	oligosaccharyltransferase complex subunit 4, non-catalytic
Database Link	NP_001128165 Entrez Gene 100128731 Human UniProt ID P0C6T2
Background	OST4 may be involved in N-glycosylation through its association with N-oligosaccharyl transferase.
Synonyms	DKFZp586A0722
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 93%; Dog: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.