C5ORF33 (NADK2) Rabbit Polyclonal Antibody
CAT#: TA338318
Rabbit Polyclonal Anti-NADK2 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 3080.00
CNY 9998.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-NADK2antibody: synthetic peptide directed towards the middle region of human C5orf33. Synthetic peptide located within the following region: RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 49 kDa | 
| Gene Name | NAD kinase 2, mitochondrial | 
| Database Link | |
| Background | The specific function of NADK2is not yet known. | 
| Synonyms | C5orf33; DECRD; MNADK; NADKD1 | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86% | 
| Reference Data | |
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
其它C5ORF33产品
