FABP9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FABP9 antibody is: synthetic peptide directed towards the middle region of Human FABP9. Synthetic peptide located within the following region: SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	fatty acid binding protein 9
Database Link	NP_001073995 Entrez Gene 646480 Human UniProt ID Q0Z7S8
Background	The function of this protein remains unknown.
Synonyms	PERF; PERF15; T-FABP; TLBP
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.