ENGASE Rabbit Polyclonal Antibody
CAT#: TA338329
Rabbit Polyclonal Anti-ENGASE Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ENGASE antibody is: synthetic peptide directed towards the N-terminal region of Human ENGASE. Synthetic peptide located within the following region: RRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | endo-beta-N-acetylglucosaminidase |
Database Link | |
Background | This gene encodes a cytosolic enzyme which catalyzes the hydrolysis of peptides and proteins with mannose modifications to produce free oligosaccharides. |
Synonyms | DKFZp434P174; FLJ21865 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Pathways | Other glycan degradation |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |