Mrpl12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Mrpl12 antibody is: synthetic peptide directed towards the middle region of Rat Mrpl12. Synthetic peptide located within the following region: RRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	mitochondrial ribosomal protein L12
Database Link	NP_001025071 Entrez Gene 303746 Rat
Background	Mrpl12 is a mitochondrial ribosomal protein.
Synonyms	5c5-2; FLJ60124; L12mt; MGC8610; MRP-L12; MRP-L31/34; MRPL7; MRPL7/L12; RPML12
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.