DOLPP1 Rabbit Polyclonal Antibody
CAT#: TA338419
Rabbit Polyclonal Anti-DOLPP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 27 kDa |
Gene Name | dolichyldiphosphatase 1 |
Database Link | |
Background | DOLPP1 is a multi-pass membrane proteinBy similarity. It belongs to the dolichyldiphosphatase family. It is required for efficient N-glycosylation and is necessary for maintaining optimal levels of dolichol-linked oligosaccharides. DOLPP1 hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. It does not act on phosphatidate. |
Synonyms | LSFR2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | N-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |