ELOVL5 Rabbit Polyclonal Antibody
CAT#: TA338477
Rabbit Polyclonal Anti-ELOVL5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 2 publications. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | ELOVL fatty acid elongase 5 |
Database Link | |
Background | ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011 |
Synonyms | dJ483K16.1; HELO1; SCA38 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Rat: 93%; Pig: 92%; Goat: 92%; Bovine: 92%; Guinea pig: 85%; Horse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Biosynthesis of unsaturated fatty acids |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
Dietary EPA and DHA prevent changes in white adipose tissue omega-3 PUFA and oxylipin content associated with a Fads2 deficiency
,Sarr, O;Payne, GW;Hucik, B;Abdelmagid, S;Nakamura, MT;Ma, DWL;Mutch, DM;,
J. Nutr. Biochem.
,PubMed ID 30368227
[ELOVL5]
|
Polyunsaturated fatty acid elongation and desaturation in activated human T-cells: ELOVL5 is the key elongase [S]
,null,
Journal of Lipid Research
,PubMed ID 30293059
[ELOVL5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |