PERP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PERP antibody: synthetic peptide directed towards the middle region of human PERP. Synthetic peptide located within the following region: FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	PERP, TP53 apoptosis effector
Database Link	NP_071404 Entrez Gene 64065 Human UniProt ID Q96FX8
Background	PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.
Synonyms	dJ496H19.1; KCP1; KRTCAP1; PIGPC1; THW
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	p53 signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.