DNAJC1 Rabbit Polyclonal Antibody
CAT#: TA338496
Rabbit Polyclonal Anti-DNAJC1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DNAJC1 antibody: synthetic peptide directed towards the middle region of human DNAJC1. Synthetic peptide located within the following region: QWHDLLPCKLGIWFCLTLKALPHLIQDAGQFYAKYKETRLKEKEDALTRT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 64 kDa |
Gene Name | DnaJ heat shock protein family (Hsp40) member C1 |
Database Link | |
Background | DNAJC1 contains 1 J domain and 2 SANT domains. The exact function of DNAJC1 remains unknown. |
Synonyms | DNAJL1; ERdj1; HTJ1; MTJ1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93% |
Reference Data | |
Protein Families | Transcription Factors, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |