GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
CAT#: TA338505
Rabbit Polyclonal Anti-GABRA5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 3 publications. |
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 49 kDa |
Gene Name | gamma-aminobutyric acid type A receptor alpha5 subunit |
Database Link | |
Background | GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Transcript variants utilizing three different alternative non-coding first exons have been described. [provided by RefSeq, Jul 2008] |
Synonyms | MGC138184 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane |
Protein Pathways | Neuroactive ligand-receptor interaction |
Citations (3)
The use of this Antibodies has been cited in the following citations: |
---|
GABA facilitates spike propagation through branch points of sensory axons in the spinal cord.
,null,
Nature neuroscience
,PubMed ID 36163283
[GABRA5]
|
Nodal GABA facilitates axon spike transmission in the spinal cord
,Hari, K;Lucas-Osma, A;Metz, K;Lin, S;Pardell, N;Roszko, D;Black, S;Minarik, A;Singla, R;Stephens, M;Fouad, K;Jones, K;Gorassini, M;Fenrich, K;Li, Y;Bennett, D;,
bioRxiv
[GABRA5]
|
Extrasynaptic ∝5GABAA receptors on proprioceptive afferents produce a tonic depolarization that modulates sodium channel function in the rat spinal cord
,Lucas-Osma, AM;Li, Y;Lin, S;Black, S;Singla, R;Fouad, K;Fenrich, KK;Bennett, DJ;,
J. Neurophysiol.
,PubMed ID 30256739
[GABRA5]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它GABA A Receptor alpha 5产品