HTR3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, IHC, WB
Recommend Dilution	WB, IHC, IF
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	5-hydroxytryptamine receptor 3B
Database Link	NP_006019 Entrez Gene 57014 MouseEntrez Gene 9177 Human UniProt ID O95264
Background	The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]
Synonyms	5-HT3B
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%; Bovine: 79%; Guinea pig: 79%; Dog: 77%; Mouse: 77%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.