KIR5.1 (KCNJ16) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Kcnj16 antibody is: synthetic peptide directed towards the C-terminal region of Rat Kcnj16. Synthetic peptide located within the following region: VTFIYTGDSTGTSHQSRSSYVPREILWGHRFHDVLEVKRKYYKVNCLQFE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	potassium voltage-gated channel subfamily J member 16
Database Link	NP_061128 Entrez Gene 29719 Rat UniProt ID Q9NPI9
Background	inward rectifying potassium channel; may be involved in renal pH regulation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BC078776.1 [ECO:0000332] ##Evidence-Data-END##
Synonyms	BIR9; KIR5.1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Potassium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.