LPPR2 (PLPPR2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LPPR2 antibody: synthetic peptide directed towards the middle region of human LPPR2. Synthetic peptide located within the following region: NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	phospholipid phosphatase related 2
Database Link	NP_073574 Entrez Gene 64748 Human UniProt ID Q96GM1
Background	LPPR2 is a multi-pass membrane protein and belongs to the PA-phosphatase related phosphoesterase family. LPPR2 shows dynamic expression regulation during brain development and neuronal excitation.
Synonyms	LPPR2; PRG4
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.