SHKBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	SH3KBP1 binding protein 1
Database Link	NP_612401 Entrez Gene 92799 Human UniProt ID Q8TBC3
Background	The function of this protein remains unknown.
Synonyms	PP203; Sb1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Families	Ion Channels: Other

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.